Lineage for d1nx3a_ (1nx3 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 641308Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)
  6. 641322Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 641326Species Pig (Sus scrofa) [TaxId:9823] [47555] (6 PDB entries)
  8. 641336Domain d1nx3a_: 1nx3 A: [92282]
    complexed with ca, isa

Details for d1nx3a_

PDB Entry: 1nx3 (more details), 2.45 Å

PDB Description: Calpain Domain VI in Complex with the Inhibitor PD150606
PDB Compounds: (A:) Calcium-dependent protease, small subunit

SCOP Domain Sequences for d1nx3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nx3a_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

SCOP Domain Coordinates for d1nx3a_:

Click to download the PDB-style file with coordinates for d1nx3a_.
(The format of our PDB-style files is described here.)

Timeline for d1nx3a_: