![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (11 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins) |
![]() | Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [47555] (6 PDB entries) |
![]() | Domain d1nx1a_: 1nx1 A: [92279] |
PDB Entry: 1nx1 (more details), 2 Å
SCOP Domain Sequences for d1nx1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nx1a_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys
Timeline for d1nx1a_: