Lineage for d1nwud2 (1nwu D:261-328)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410016Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 410161Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 410162Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 410219Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)
  7. 410220Species Human (Homo sapiens) [TaxId:9606] [89885] (7 PDB entries)
  8. 410228Domain d1nwud2: 1nwu D:261-328 [92276]
    Other proteins in same PDB: d1nwua1, d1nwub1, d1nwuc1, d1nwud1
    complexed with nag

Details for d1nwud2

PDB Entry: 1nwu (more details), 2.2 Å

PDB Description: crystal structure of human cartilage gp39 (hc-gp39) in complex with chitotetraose

SCOP Domain Sequences for d1nwud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwud2 d.26.3.1 (D:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

SCOP Domain Coordinates for d1nwud2:

Click to download the PDB-style file with coordinates for d1nwud2.
(The format of our PDB-style files is described here.)

Timeline for d1nwud2: