Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89885] (7 PDB entries) |
Domain d1nwsb2: 1nws B:261-328 [92256] Other proteins in same PDB: d1nwsa1, d1nwsb1, d1nwsc1, d1nwsd1 |
PDB Entry: 1nws (more details), 2.7 Å
SCOP Domain Sequences for d1nwsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nwsb2 d.26.3.1 (B:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)} fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat kgnqwvgy
Timeline for d1nwsb2: