Lineage for d1nwra2 (1nwr A:261-328)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410016Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 410161Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 410162Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 410219Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)
  7. 410220Species Human (Homo sapiens) [TaxId:9606] [89885] (7 PDB entries)
  8. 410235Domain d1nwra2: 1nwr A:261-328 [92246]
    Other proteins in same PDB: d1nwra1, d1nwrb1, d1nwrc1, d1nwrd1

Details for d1nwra2

PDB Entry: 1nwr (more details), 2.7 Å

PDB Description: crystal structure of human cartilage gp39 (hc-gp39)

SCOP Domain Sequences for d1nwra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwra2 d.26.3.1 (A:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

SCOP Domain Coordinates for d1nwra2:

Click to download the PDB-style file with coordinates for d1nwra2.
(The format of our PDB-style files is described here.)

Timeline for d1nwra2: