Lineage for d1nw2e_ (1nw2 E:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584502Family c.47.1.1: Thioltransferase [52834] (13 proteins)
  6. 584553Protein Thioredoxin [52835] (12 species)
  7. 584554Species Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId:405212] [52839] (4 PDB entries)
  8. 584559Domain d1nw2e_: 1nw2 E: [92219]

Details for d1nw2e_

PDB Entry: 1nw2 (more details), 1.9 Å

PDB Description: The crystal structure of the mutant R82E of Thioredoxin from Alicyclobacillus acidocaldarius
PDB Compounds: (E:)

SCOP Domain Sequences for d1nw2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nw2e_ c.47.1.1 (E:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius}
atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq

SCOP Domain Coordinates for d1nw2e_:

Click to download the PDB-style file with coordinates for d1nw2e_.
(The format of our PDB-style files is described here.)

Timeline for d1nw2e_: