Lineage for d1nw2d_ (1nw2 D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395824Family c.47.1.1: Thioltransferase [52834] (9 proteins)
  6. 395871Protein Thioredoxin [52835] (9 species)
  7. 395872Species Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId:405212] [52839] (3 PDB entries)
  8. 395876Domain d1nw2d_: 1nw2 D: [92218]

Details for d1nw2d_

PDB Entry: 1nw2 (more details), 1.9 Å

PDB Description: The crystal structure of the mutant R82E of Thioredoxin from Alicyclobacillus acidocaldarius

SCOP Domain Sequences for d1nw2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nw2d_ c.47.1.1 (D:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius}
atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq

SCOP Domain Coordinates for d1nw2d_:

Click to download the PDB-style file with coordinates for d1nw2d_.
(The format of our PDB-style files is described here.)

Timeline for d1nw2d_: