Lineage for d1nvpd1 (1nvp D:3-53)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709245Fold a.32: Transcription factor IIA (TFIIA), alpha-helical domain [47395] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 2709246Superfamily a.32.1: Transcription factor IIA (TFIIA), alpha-helical domain [47396] (1 family) (S)
    dimer of non-identical alpha-hairpins
  5. 2709247Family a.32.1.1: Transcription factor IIA (TFIIA), alpha-helical domain [47397] (2 proteins)
    heterodimer of two homologous chains
  6. 2709254Protein Small chain TOA2, N-terminal domain [88835] (2 species)
  7. 2709259Species Human (Homo sapiens) [TaxId:9606] [101165] (1 PDB entry)
  8. 2709260Domain d1nvpd1: 1nvp D:3-53 [92213]
    Other proteins in same PDB: d1nvpa1, d1nvpa2, d1nvpb_, d1nvpc_, d1nvpd2
    protein/DNA complex

Details for d1nvpd1

PDB Entry: 1nvp (more details), 2.1 Å

PDB Description: human tfiia/tbp/dna complex
PDB Compounds: (D:) Transcription initiation factor IIA gamma chain

SCOPe Domain Sequences for d1nvpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvpd1 a.32.1.1 (D:3-53) Small chain TOA2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
yqlyrnttlgnslqesldeliqsqqitpqlalqvllqfdkainaalaqrvr

SCOPe Domain Coordinates for d1nvpd1:

Click to download the PDB-style file with coordinates for d1nvpd1.
(The format of our PDB-style files is described here.)

Timeline for d1nvpd1:

2709260
d1nvpd1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1nvpd2