SCOP 1.69: Domain d1nvpa2: 1nvp A:253-338

Lineage for d1nvpa2 (1nvp A:253-338)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.129: TBP-like [55944] (8 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries)

8. Domain d1nvpa2: 1nvp A:253-338 [92210]
   Other proteins in same PDB: d1nvpb_, d1nvpc_, d1nvpd1, d1nvpd2

Details for d1nvpa2

PDB Entry: 1nvp, 2.1 Å

PDB Description: human tfiia/tbp/dna complex

SCOP Domain Sequences for d1nvpa2:

Sequence; same for both SEQRES and ATOM records:

>d1nvpa2 d.129.1.1 (A:253-338) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)}
fkiqnmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikprivllifvsgkvvl
tgakvraeiyeafeniypilkgfrkt

Timeline for d1nvpa2:

• d1nvpa2 first appeared in SCOP 1.67
  
• d1nvpa2 appears in SCOP 1.71
  
• d1nvpa2 appears in the current release, SCOPe 2.08