Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.129: TBP-like [55944] (8 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries) |
Domain d1nvpa2: 1nvp A:253-338 [92210] Other proteins in same PDB: d1nvpb_, d1nvpc_, d1nvpd1, d1nvpd2 |
PDB Entry: 1nvp (more details), 2.1 Å
SCOP Domain Sequences for d1nvpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nvpa2 d.129.1.1 (A:253-338) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)} fkiqnmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikprivllifvsgkvvl tgakvraeiyeafeniypilkgfrkt
Timeline for d1nvpa2:
View in 3D Domains from other chains: (mouse over for more information) d1nvpb_, d1nvpc_, d1nvpd1, d1nvpd2 |