SCOPe 2.03: Domain d1nu1k_: 1nu1 K:

Lineage for d1nu1k_ (1nu1 K:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family)
   automatically mapped to Pfam PF08997

5. Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins)

6. Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
   the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located

7. Species Cow (Bos taurus) [TaxId:9913] [81515] (12 PDB entries)
   Uniprot P07552

8. Domain d1nu1k_: 1nu1 K: [92182]
   Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1j_
   complexed with fes, hem, qno

Details for d1nu1k_

PDB Entry: 1nu1, 3.2 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complexed with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO)

PDB Compounds: (K:) Ubiquinol-cytochrome c reductase complex 6.4 kDa protein

SCOPe Domain Sequences for d1nu1k_:

Sequence; same for both SEQRES and ATOM records:

>d1nu1k_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaqlwgavgavglvwatdwrlildwvpyingkfk

Timeline for d1nu1k_:

• d1nu1k_ first appeared in SCOP 1.67
  
• d1nu1k_ appears in SCOPe 2.02
  
• d1nu1k_ appears in SCOPe 2.04
  
• d1nu1k_ appears in the current release, SCOPe 2.08