![]() | Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) ![]() |
![]() | Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (1 protein) |
![]() | Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species) the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81515] (10 PDB entries) |
![]() | Domain d1nu1k_: 1nu1 K: [92182] Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1j_ complexed with fes, hem, qno |
PDB Entry: 1nu1 (more details), 3.2 Å
SCOP Domain Sequences for d1nu1k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nu1k_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)} mltrflgpryrqlarnwvptaqlwgavgavglvwatdwrlildwvpyingkfk
Timeline for d1nu1k_: