![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() |
![]() | Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein) |
![]() | Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81509] (12 PDB entries) |
![]() | Domain d1nu1j_: 1nu1 J: [92181] Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1k_ |
PDB Entry: 1nu1 (more details), 3.2 Å
SCOP Domain Sequences for d1nu1j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nu1j_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)} vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye n
Timeline for d1nu1j_: