| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) ![]() not a true superfamily |
| Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins) beta-hairpin and a short alpha-helix bound to the core subunits |
| Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries) there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop Uniprot P13272 1-57 ! Uniprot P13272 |
| Domain d1nu1i_: 1nu1 I: [92180] Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1j_, d1nu1k_ complexed with fes, hem, qno |
PDB Entry: 1nu1 (more details), 3.2 Å
SCOPe Domain Sequences for d1nu1i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nu1i_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
Timeline for d1nu1i_: