SCOPe 2.03: Domain d1nu1f_: 1nu1 F:

Lineage for d1nu1f_ (1nu1 F:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex
   automatically mapped to Pfam PF02271

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81519] (14 PDB entries)
   Uniprot P00129

8. Domain d1nu1f_: 1nu1 F: [92177]
   Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1j_, d1nu1k_
   complexed with fes, hem, qno

Details for d1nu1f_

PDB Entry: 1nu1, 3.2 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complexed with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO)

PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOPe Domain Sequences for d1nu1f_:

Sequence; same for both SEQRES and ATOM records:

>d1nu1f_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d1nu1f_:

• d1nu1f_ first appeared in SCOP 1.67
  
• d1nu1f_ appears in SCOPe 2.02
  
• d1nu1f_ appears in SCOPe 2.04
  
• d1nu1f_ appears in the current release, SCOPe 2.08