Lineage for d1nu1e2 (1nu1 E:1-69)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958070Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 1958071Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 1958072Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 1958088Species Cow (Bos taurus) [TaxId:9913] [81497] (17 PDB entries)
    Uniprot P13272; precursor of chains I,E and V,R
  8. 1958104Domain d1nu1e2: 1nu1 E:1-69 [92176]
    Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1d2, d1nu1e1, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1j_, d1nu1k_
    complexed with fes, hem, qno

Details for d1nu1e2

PDB Entry: 1nu1 (more details), 3.2 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complexed with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO)
PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d1nu1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nu1e2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOPe Domain Coordinates for d1nu1e2:

Click to download the PDB-style file with coordinates for d1nu1e2.
(The format of our PDB-style files is described here.)

Timeline for d1nu1e2: