Class b: All beta proteins [48724] (144 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (2 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins) |
Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [50025] (10 PDB entries) |
Domain d1nu1e1: 1nu1 E:70-196 [92175] Other proteins in same PDB: d1nu1a1, d1nu1a2, d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1d2, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1j_, d1nu1k_ |
PDB Entry: 1nu1 (more details), 3.2 Å
SCOP Domain Sequences for d1nu1e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nu1e1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus)} amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts ddmvivg
Timeline for d1nu1e1: