Details for d1nu1d2

PDB Entry: 1nu1 (more details), 3.2 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complexed with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO)

SCOP Domain Sequences for d1nu1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nu1d2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus)}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOP Domain Coordinates for d1nu1d2:

Click to download the PDB-style file with coordinates for d1nu1d2.
(The format of our PDB-style files is described here.)

Timeline for d1nu1d2: