SCOPe 2.03: Domain d1nu1a1: 1nu1 A:1-233

Lineage for d1nu1a1 (1nu1 A:1-233)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 1 [63408] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55997] (18 PDB entries)
   Uniprot P31800

8. Domain d1nu1a1: 1nu1 A:1-233 [92167]
   Other proteins in same PDB: d1nu1b1, d1nu1b2, d1nu1c1, d1nu1c2, d1nu1d1, d1nu1d2, d1nu1e1, d1nu1e2, d1nu1f_, d1nu1g_, d1nu1h_, d1nu1i_, d1nu1j_, d1nu1k_
   complexed with fes, hem, qno

Details for d1nu1a1

PDB Entry: 1nu1, 3.2 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complexed with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO)

PDB Compounds: (A:) Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial

SCOPe Domain Sequences for d1nu1a1:

Sequence; same for both SEQRES and ATOM records:

>d1nu1a1 d.185.1.1 (A:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp

Timeline for d1nu1a1:

• d1nu1a1 first appeared in SCOP 1.67
  
• d1nu1a1 appears in SCOPe 2.02
  
• d1nu1a1 appears in SCOPe 2.04
  
• d1nu1a1 appears in the current release, SCOPe 2.08