Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) not a true superfamily |
Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins) beta-hairpin and a short alpha-helix bound to the core subunits |
Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries) there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop Uniprot P13272 1-57 ! Uniprot P13272 |
Domain d1ntzi_: 1ntz I: [92162] Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntze2, d1ntzf_, d1ntzg_, d1ntzh_, d1ntzj_, d1ntzk_ complexed with fes, hem, uq2 |
PDB Entry: 1ntz (more details), 2.6 Å
SCOPe Domain Sequences for d1ntzi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntzi_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]} mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
Timeline for d1ntzi_: