Lineage for d1ntzi_ (1ntz I:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684532Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 1684533Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 1684548Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 1684549Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 1684550Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries)
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
    Uniprot P13272 1-57 ! Uniprot P13272
  8. 1684560Domain d1ntzi_: 1ntz I: [92162]
    Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntze2, d1ntzf_, d1ntzg_, d1ntzh_, d1ntzj_, d1ntzk_
    complexed with fes, hem, uq2

Details for d1ntzi_

PDB Entry: 1ntz (more details), 2.6 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone
PDB Compounds: (I:) ubiquinol-cytochrome c reductase 8 kda protein

SCOPe Domain Sequences for d1ntzi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntzi_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

SCOPe Domain Coordinates for d1ntzi_:

Click to download the PDB-style file with coordinates for d1ntzi_.
(The format of our PDB-style files is described here.)

Timeline for d1ntzi_: