Lineage for d1ntzg_ (1ntz G:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631316Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 2631317Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 2631318Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 2631338Species Cow (Bos taurus) [TaxId:9913] [81503] (21 PDB entries)
    Uniprot P13271 #SP ! Uniprot P13271
  8. 2631348Domain d1ntzg_: 1ntz G: [92160]
    Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntze2, d1ntzf_, d1ntzh_, d1ntzi_, d1ntzj_, d1ntzk_
    complexed with fes, hem, uq2

Details for d1ntzg_

PDB Entry: 1ntz (more details), 2.6 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone
PDB Compounds: (G:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d1ntzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntzg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

SCOPe Domain Coordinates for d1ntzg_:

Click to download the PDB-style file with coordinates for d1ntzg_.
(The format of our PDB-style files is described here.)

Timeline for d1ntzg_: