Lineage for d1ntzg_ (1ntz G:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519895Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 520164Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
  5. 520165Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)
  6. 520166Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 520177Species Cow (Bos taurus) [TaxId:9913] [81503] (12 PDB entries)
  8. 520181Domain d1ntzg_: 1ntz G: [92160]
    Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntze2, d1ntzf_, d1ntzh_, d1ntzi_, d1ntzj_, d1ntzk_

Details for d1ntzg_

PDB Entry: 1ntz (more details), 2.6 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone

SCOP Domain Sequences for d1ntzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntzg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

SCOP Domain Coordinates for d1ntzg_:

Click to download the PDB-style file with coordinates for d1ntzg_.
(The format of our PDB-style files is described here.)

Timeline for d1ntzg_: