Lineage for d1ntze2 (1ntz E:1-69)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698284Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 1698285Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 1698286Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 1698302Species Cow (Bos taurus) [TaxId:9913] [81497] (17 PDB entries)
    Uniprot P13272; precursor of chains I,E and V,R
  8. 1698312Domain d1ntze2: 1ntz E:1-69 [92158]
    Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntzf_, d1ntzg_, d1ntzh_, d1ntzi_, d1ntzj_, d1ntzk_
    complexed with fes, hem, uq2

Details for d1ntze2

PDB Entry: 1ntz (more details), 2.6 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone
PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d1ntze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntze2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOPe Domain Coordinates for d1ntze2:

Click to download the PDB-style file with coordinates for d1ntze2.
(The format of our PDB-style files is described here.)

Timeline for d1ntze2: