Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) |
Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81497] (12 PDB entries) Uniprot P13272; precursor of chains I,E and V,R |
Domain d1ntze2: 1ntz E:1-69 [92158] Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntzf_, d1ntzg_, d1ntzh_, d1ntzi_, d1ntzj_, d1ntzk_ complexed with fes, hem, uq2 |
PDB Entry: 1ntz (more details), 2.6 Å
SCOPe Domain Sequences for d1ntze2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntze2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]} shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs smsasadvl
Timeline for d1ntze2: