SCOPe 2.01: Domain d1ntze1: 1ntz E:70-196

Lineage for d1ntze1 (1ntz E:70-196)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)

Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

Superfamily b.33.1: ISP domain [50022] (4 families)
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
Species Cow (Bos taurus) [TaxId:9913] [50025] (10 PDB entries)

Domain d1ntze1: 1ntz E:70-196 [92157]
Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze2, d1ntzf_, d1ntzg_, d1ntzh_, d1ntzi_, d1ntzj_, d1ntzk_
complexed with fes, hem, uq2

Details for d1ntze1

PDB Entry: 1ntz (more details), 2.6 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone

PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d1ntze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntze1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOPe Domain Coordinates for d1ntze1:

Click to download the PDB-style file with coordinates for d1ntze1.
(The format of our PDB-style files is described here.)

Timeline for d1ntze1: