SCOPe 2.07: Domain d1ntzd1: 1ntz D:1-195

Lineage for d1ntzd1 (1ntz D:1-195)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein Cytochrome bc1 domain [46677] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46678] (19 PDB entries)
   Uniprot P00125

8. Domain d1ntzd1: 1ntz D:1-195 [92155]
   Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd2, d1ntze1, d1ntze2, d1ntzf_, d1ntzg_, d1ntzh_, d1ntzi_, d1ntzj_, d1ntzk_
   complexed with fes, hem, uq2

Details for d1ntzd1

PDB Entry: 1ntz, 2.6 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone

PDB Compounds: (D:) cytochrome c1

SCOPe Domain Sequences for d1ntzd1:

Sequence; same for both SEQRES and ATOM records:

>d1ntzd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

Timeline for d1ntzd1:

• d1ntzd1 first appeared in SCOP 1.67
  
• d1ntzd1 appears in SCOPe 2.06
  
• d1ntzd1 appears in the current release, SCOPe 2.08