![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() automatically mapped to Pfam PF05365 |
![]() | Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
![]() | Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries) Uniprot P00130 |
![]() | Domain d1ntmj_: 1ntm J: [92135] Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmb1, d1ntmb2, d1ntmc1, d1ntmc2, d1ntmd1, d1ntmd2, d1ntme1, d1ntme2, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmk_ complexed with fes, hem |
PDB Entry: 1ntm (more details), 2.4 Å
SCOPe Domain Sequences for d1ntmj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntmj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
Timeline for d1ntmj_: