SCOPe 2.03: Domain d1ntmj_: 1ntm J:

Lineage for d1ntmj_ (1ntm J:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)
   automatically mapped to Pfam PF05365

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)

6. Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
   interacts with cytochrome c1 and ISP

7. Species Cow (Bos taurus) [TaxId:9913] [81509] (18 PDB entries)
   Uniprot P00130

8. Domain d1ntmj_: 1ntm J: [92135]
   Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmb1, d1ntmb2, d1ntmc1, d1ntmc2, d1ntmd1, d1ntmd2, d1ntme1, d1ntme2, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmk_
   complexed with fes, hem

Details for d1ntmj_

PDB Entry: 1ntm, 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom

PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOPe Domain Sequences for d1ntmj_:

Sequence; same for both SEQRES and ATOM records:

>d1ntmj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye

Timeline for d1ntmj_:

• d1ntmj_ first appeared in SCOP 1.67
  
• d1ntmj_ appears in SCOPe 2.02
  
• d1ntmj_ appears in SCOPe 2.04
  
• d1ntmj_ appears in the current release, SCOPe 2.08