Details for d1ntmd2

PDB Entry: 1ntm (more details), 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom

SCOP Domain Sequences for d1ntmd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntmd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus)}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOP Domain Coordinates for d1ntmd2:

Click to download the PDB-style file with coordinates for d1ntmd2.
(The format of our PDB-style files is described here.)

Timeline for d1ntmd2: