SCOPe 2.08: Domain d1ntmb2: 1ntm B:236-439

Lineage for d1ntmb2 (1ntm B:236-439)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56000] (19 PDB entries)
   Uniprot P23004

8. Domain d1ntmb2: 1ntm B:236-439 [92124]
   Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmc1, d1ntmc2, d1ntmd1, d1ntmd2, d1ntme1, d1ntme2, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmj_, d1ntmk_
   complexed with fes, hem

Details for d1ntmb2

PDB Entry: 1ntm, 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom

PDB Compounds: (B:) Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial

SCOPe Domain Sequences for d1ntmb2:

Sequence; same for both SEQRES and ATOM records:

>d1ntmb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

Timeline for d1ntmb2:

• d1ntmb2 first appeared in SCOP 1.67
  
• d1ntmb2 appears in SCOPe 2.07