Lineage for d1ntmb1 (1ntm B:17-235)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 422251Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 422252Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 422253Family d.185.1.1: MPP-like [63412] (4 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 422294Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 422313Species Cow (Bos taurus) [TaxId:9913] [56000] (9 PDB entries)
  8. 422320Domain d1ntmb1: 1ntm B:17-235 [92123]
    Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmc1, d1ntmc2, d1ntmd1, d1ntmd2, d1ntme1, d1ntme2, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmj_, d1ntmk_

Details for d1ntmb1

PDB Entry: 1ntm (more details), 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom

SCOP Domain Sequences for d1ntmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntmb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)}
vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
nhftsarmaliglgvshpvlkqvaeqflnirgglglsga

SCOP Domain Coordinates for d1ntmb1:

Click to download the PDB-style file with coordinates for d1ntmb1.
(The format of our PDB-style files is described here.)

Timeline for d1ntmb1: