![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
![]() | Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) ![]() not a true superfamily |
![]() | Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein) beta-hairpin and a short alpha-helix bound to the core subunits |
![]() | Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [90079] (9 PDB entries) there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop |
![]() | Domain d1ntki_: 1ntk I: [92118] Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkg_, d1ntkh_, d1ntkj_, d1ntkk_ |
PDB Entry: 1ntk (more details), 2.6 Å
SCOP Domain Sequences for d1ntki_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntki_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus)} mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
Timeline for d1ntki_: