Lineage for d1ntkh_ (1ntk H:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888118Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 888119Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
  5. 888120Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 888121Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 888137Species Cow (Bos taurus) [TaxId:9913] [81526] (18 PDB entries)
    Uniprot P00126
  8. 888150Domain d1ntkh_: 1ntk H: [92117]
    Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkg_, d1ntki_, d1ntkj_, d1ntkk_
    complexed with ay1, fes, hem

Details for d1ntkh_

PDB Entry: 1ntk (more details), 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOP Domain Sequences for d1ntkh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntkh_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
pkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldfl
hardhcvahklfnslk

SCOP Domain Coordinates for d1ntkh_:

Click to download the PDB-style file with coordinates for d1ntkh_.
(The format of our PDB-style files is described here.)

Timeline for d1ntkh_: