SCOP 1.75: Domain d1ntkg_: 1ntk G:

Lineage for d1ntkg_ (1ntk G:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries)
   Uniprot P13271 #SP
   Uniprot P13271
   Uniprot P13271 #SP ! Uniprot P13271

8. Domain d1ntkg_: 1ntk G: [92116]
   Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkh_, d1ntki_, d1ntkj_, d1ntkk_
   complexed with ay1, fes, hem

Details for d1ntkg_

PDB Entry: 1ntk, 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1

PDB Compounds: (G:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOP Domain Sequences for d1ntkg_:

Sequence; same for both SEQRES and ATOM records:

>d1ntkg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpaayen

Timeline for d1ntkg_:

• d1ntkg_ first appeared in SCOP 1.67
  
• d1ntkg_ appears in SCOP 1.73
  
• d1ntkg_ appears in SCOPe 2.01
  
• d1ntkg_ appears in the current release, SCOPe 2.08