| Class b: All beta proteins [48724] (178 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
| Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [50025] (20 PDB entries) |
| Domain d1ntke1: 1ntk E:70-196 [92113] Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke2, d1ntkf_, d1ntkg_, d1ntkh_, d1ntki_, d1ntkj_, d1ntkk_ complexed with ay1, fes, hem |
PDB Entry: 1ntk (more details), 2.6 Å
SCOPe Domain Sequences for d1ntke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntke1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg
Timeline for d1ntke1: