Lineage for d1ntkd2 (1ntk D:196-241)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059826Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family) (S)
  5. 1059827Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)
  6. 1059828Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)
  7. 1059844Species Cow (Bos taurus) [TaxId:9913] [81491] (18 PDB entries)
    Uniprot P00125
  8. 1059856Domain d1ntkd2: 1ntk D:196-241 [92112]
    Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntke1, d1ntke2, d1ntkf_, d1ntkg_, d1ntkh_, d1ntki_, d1ntkj_, d1ntkk_
    complexed with ay1, fes, hem

Details for d1ntkd2

PDB Entry: 1ntk (more details), 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
PDB Compounds: (D:) cytochrome c1

SCOPe Domain Sequences for d1ntkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntkd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOPe Domain Coordinates for d1ntkd2:

Click to download the PDB-style file with coordinates for d1ntkd2.
(The format of our PDB-style files is described here.)

Timeline for d1ntkd2: