Lineage for d1ntkd1 (1ntk D:1-195)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1720126Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 1720127Protein Cytochrome bc1 domain [46677] (3 species)
  7. 1720143Species Cow (Bos taurus) [TaxId:9913] [46678] (17 PDB entries)
    Uniprot P00125
  8. 1720155Domain d1ntkd1: 1ntk D:1-195 [92111]
    Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkg_, d1ntkh_, d1ntki_, d1ntkj_, d1ntkk_
    complexed with ay1, fes, hem

Details for d1ntkd1

PDB Entry: 1ntk (more details), 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
PDB Compounds: (D:) cytochrome c1

SCOPe Domain Sequences for d1ntkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntkd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d1ntkd1:

Click to download the PDB-style file with coordinates for d1ntkd1.
(The format of our PDB-style files is described here.)

Timeline for d1ntkd1: