Lineage for d1ntkc1 (1ntk C:261-379)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620935Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 620936Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 620937Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 620938Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 620949Species Cow (Bos taurus) [TaxId:9913] [81643] (12 PDB entries)
  8. 620957Domain d1ntkc1: 1ntk C:261-379 [92109]
    Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkg_, d1ntkh_, d1ntki_, d1ntkj_, d1ntkk_
    complexed with ay1, fes, hem

Details for d1ntkc1

PDB Entry: 1ntk (more details), 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1

SCOP Domain Sequences for d1ntkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntkc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus)}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOP Domain Coordinates for d1ntkc1:

Click to download the PDB-style file with coordinates for d1ntkc1.
(The format of our PDB-style files is described here.)

Timeline for d1ntkc1: