Lineage for d1ntkb2 (1ntk B:236-439)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611057Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2611058Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2611059Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2611136Protein Cytochrome bc1 core subunit 2 [63409] (4 species)
  7. 2611165Species Cow (Bos taurus) [TaxId:9913] [56000] (19 PDB entries)
    Uniprot P23004
  8. 2611197Domain d1ntkb2: 1ntk B:236-439 [92108]
    Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkg_, d1ntkh_, d1ntki_, d1ntkj_, d1ntkk_
    complexed with ay1, fes, hem

Details for d1ntkb2

PDB Entry: 1ntk (more details), 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
PDB Compounds: (B:) Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial

SCOPe Domain Sequences for d1ntkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntkb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

SCOPe Domain Coordinates for d1ntkb2:

Click to download the PDB-style file with coordinates for d1ntkb2.
(The format of our PDB-style files is described here.)

Timeline for d1ntkb2: