SCOPe 2.08: Domain d1ntka1: 1ntk A:1-233

Lineage for d1ntka1 (1ntk A:1-233)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 1 [63408] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55997] (19 PDB entries)
   Uniprot P31800

8. Domain d1ntka1: 1ntk A:1-233 [92105]
   Other proteins in same PDB: d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkg_, d1ntkh_, d1ntki_, d1ntkj_, d1ntkk_
   complexed with ay1, fes, hem

Details for d1ntka1

PDB Entry: 1ntk, 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1

PDB Compounds: (A:) Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial

SCOPe Domain Sequences for d1ntka1:

Sequence; same for both SEQRES and ATOM records:

>d1ntka1 d.185.1.1 (A:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp

Timeline for d1ntka1:

• d1ntka1 first appeared in SCOP 1.67
  
• d1ntka1 appears in SCOPe 2.07