Lineage for d1nt4b_ (1nt4 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143621Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2143622Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2143774Family c.60.1.2: Histidine acid phosphatase [53258] (4 proteins)
  6. 2143775Protein Glucose-1-phosphatase [102533] (1 species)
  7. 2143776Species Escherichia coli [TaxId:562] [102534] (1 PDB entry)
  8. 2143778Domain d1nt4b_: 1nt4 B: [92103]
    complexed with g1p; mutant

Details for d1nt4b_

PDB Entry: 1nt4 (more details), 2.4 Å

PDB Description: crystal structure of escherichia coli periplasmic glucose-1- phosphatase h18a mutant complexed with glucose-1-phosphate
PDB Compounds: (B:) Glucose-1-phosphatase

SCOPe Domain Sequences for d1nt4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nt4b_ c.60.1.2 (B:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]}
qtvpegyqlqqvlmmsranlraplanngsvleqstpnkwpewdvpggqlttkggvlevym
ghymrewlaeqgmvksgecpppytvyayanslqrtvataqffitgafpgcdipvhhqekm
gtmdptfnpvitddsaafseqavaamekelsklqltdsyqllekivnykdspackekqqc
slvdgkntfsakyqqepgvsgplkvgnslvdaftlqyyegfpmdqvawgeiksdqqwkvl
sklkngyqdslftspevarnvakplvsyidkalvtdrtsapkitvlvghdsniaslltal
dfkpyqlhdqnertpiggkivfqrwhdskanrdlmkieyvyqsaeqlrnadaltlqapaq
rvtlelsgcpidadgfcpmdkfdsvlneavk

SCOPe Domain Coordinates for d1nt4b_:

Click to download the PDB-style file with coordinates for d1nt4b_.
(The format of our PDB-style files is described here.)

Timeline for d1nt4b_: