Lineage for d1nt4a_ (1nt4 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489762Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 489763Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 489803Family c.60.1.2: Histidine acid phosphatase [53258] (3 proteins)
  6. 489804Protein Glucose-1-phosphatase [102533] (1 species)
  7. 489805Species Escherichia coli [TaxId:562] [102534] (1 PDB entry)
  8. 489806Domain d1nt4a_: 1nt4 A: [92102]

Details for d1nt4a_

PDB Entry: 1nt4 (more details), 2.4 Å

PDB Description: crystal structure of escherichia coli periplasmic glucose-1- phosphatase h18a mutant complexed with glucose-1-phosphate

SCOP Domain Sequences for d1nt4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli}
qtvpegyqlqqvlmmsranlraplanngsvleqstpnkwpewdvpggqlttkggvlevym
ghymrewlaeqgmvksgecpppytvyayanslqrtvataqffitgafpgcdipvhhqekm
gtmdptfnpvitddsaafseqavaamekelsklqltdsyqllekivnykdspackekqqc
slvdgkntfsakyqqepgvsgplkvgnslvdaftlqyyegfpmdqvawgeiksdqqwkvl
sklkngyqdslftspevarnvakplvsyidkalvtdrtsapkitvlvghdsniaslltal
dfkpyqlhdqnertpiggkivfqrwhdskanrdlmkieyvyqsaeqlrnadaltlqapaq
rvtlelsgcpidadgfcpmdkfdsvlneavk

SCOP Domain Coordinates for d1nt4a_:

Click to download the PDB-style file with coordinates for d1nt4a_.
(The format of our PDB-style files is described here.)

Timeline for d1nt4a_: