Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (14 families) |
Family c.47.1.1: Thioltransferase [52834] (9 proteins) |
Protein Thioredoxin [52835] (9 species) |
Species Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId:405212] [52839] (3 PDB entries) |
Domain d1nswc_: 1nsw C: [92099] |
PDB Entry: 1nsw (more details), 1.9 Å
SCOP Domain Sequences for d1nswc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nswc_ c.47.1.1 (C:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius} atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq
Timeline for d1nswc_: