SCOP 1.73: Domain d1nswb_: 1nsw B:

Lineage for d1nswb_ (1nsw B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId:405212] [52839] (4 PDB entries)

8. Domain d1nswb_: 1nsw B: [92098]

Details for d1nswb_

PDB Entry: 1nsw, 1.9 Å

PDB Description: the crystal structure of the k18g mutant of the thioredoxin from alicyclobacillus acidocaldarius

PDB Compounds: (B:) thioredoxin

SCOP Domain Sequences for d1nswb_:

Sequence; same for both SEQRES and ATOM records:

>d1nswb_ c.47.1.1 (B:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]}
atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq

Timeline for d1nswb_:

• d1nswb_ first appeared in SCOP 1.67
  
• d1nswb_ appears in SCOP 1.71
  
• d1nswb_ appears in SCOP 1.75
  
• d1nswb_ appears in the current release, SCOPe 2.08