SCOPe 2.06: Domain d1ns9b_: 1ns9 B:

Lineage for d1ns9b_ (1ns9 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46504] (17 PDB entries)

8. Domain d1ns9b_: 1ns9 B: [92096]
   Other proteins in same PDB: d1ns9a_
   complexed with hem

Details for d1ns9b_

PDB Entry: 1ns9, 1.6 Å

PDB Description: the 1.6a structure of horse methemoglobin at ph 7.1

PDB Compounds: (B:) Hemoglobin beta subunit

SCOPe Domain Sequences for d1ns9b_:

Sequence; same for both SEQRES and ATOM records:

>d1ns9b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

Timeline for d1ns9b_:

• d1ns9b_ first appeared in SCOP 1.67
  
• d1ns9b_ appears in SCOPe 2.05
  
• d1ns9b_ appears in SCOPe 2.07
  
• d1ns9b_ appears in the current release, SCOPe 2.08