Lineage for d1ns9a_ (1ns9 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1473405Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1473500Species Horse (Equus caballus) [TaxId:9796] [46488] (16 PDB entries)
  8. 1473503Domain d1ns9a_: 1ns9 A: [92095]
    Other proteins in same PDB: d1ns9b_
    complexed with hem

Details for d1ns9a_

PDB Entry: 1ns9 (more details), 1.6 Å

PDB Description: the 1.6a structure of horse methemoglobin at ph 7.1
PDB Compounds: (A:) Hemoglobin alpha subunit

SCOPe Domain Sequences for d1ns9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ns9a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d1ns9a_:

Click to download the PDB-style file with coordinates for d1ns9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ns9a_: