Lineage for d1nrhx2 (1nrh X:170-445)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420654Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 420655Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 420819Family d.162.1.2: AglA-like glucosidase [90050] (3 proteins)
    family 4 glycosyl hydrolase
  6. 420824Protein Maltose-6'-phosphate glucosidase GlvA [103329] (1 species)
  7. 420825Species Bacillus subtilis [TaxId:1423] [103330] (1 PDB entry)
  8. 420826Domain d1nrhx2: 1nrh X:170-445 [92088]
    Other proteins in same PDB: d1nrhx1
    complexed with g6p, mn, nad

Details for d1nrhx2

PDB Entry: 1nrh (more details), 2.05 Å

PDB Description: crystal structure of glva gene product from bacillus subtilis, a metal-requiring, nad-dependent 6-phospho-alpha-glucosidase

SCOP Domain Sequences for d1nrhx2:

Sequence, based on SEQRES records: (download)

>d1nrhx2 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis}
icdmpvgiedrmaqilglssrkemkvryyglnhfgwwtsiqdqegndlmpklkehvsqyg
yipkteaeaveaswndtfakardvqaadpdtlpntylqyylfpddmvkksnpnhtranev
megreafifsqcdmitreqssenseikiddhasyivdlaraiayntgermllivenngai
anfdptamvevpcivgsngpepitvgtipqfqkglmeqqvsvekltveawaeksfqklwq
alilsktvpnarvarliledlveankdfwpeldqsp

Sequence, based on observed residues (ATOM records): (download)

>d1nrhx2 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis}
icdmpvgiedrmaqilglssrkemkvryyglnhfgwwtsiqdqegndlmpklkehvsqyg
yipktswndtfakardvqaadpdtlpntylqyylfpddmvkksnpnhtranevmegreaf
ifsqcdmitreqssenseikiddhasyivdlaraiayntgermllivenngaianfdpta
mvevpcivgsngpepitvgtipqfqkglmeqqvsvekltveawaeksfqklwqalilskt
vpnarvarliledlveankdfwpeldqsp

SCOP Domain Coordinates for d1nrhx2:

Click to download the PDB-style file with coordinates for d1nrhx2.
(The format of our PDB-style files is described here.)

Timeline for d1nrhx2:

  • d1nrhx2 is new in SCOP 1.67
  • d1nrhx2 became obsolete in SCOP 1.69

View in 3D
Domains from same chain:
(mouse over for more information)
d1nrhx1