Lineage for d1nrhx1 (1nrh X:3-169)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388231Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins)
  6. 388393Protein Maltose-6'-phosphate glucosidase GlvA [102169] (1 species)
  7. 388394Species Bacillus subtilis [TaxId:1423] [102170] (1 PDB entry)
  8. 388395Domain d1nrhx1: 1nrh X:3-169 [92087]
    Other proteins in same PDB: d1nrhx2
    complexed with g6p, mn, nad

Details for d1nrhx1

PDB Entry: 1nrh (more details), 2.05 Å

PDB Description: crystal structure of glva gene product from bacillus subtilis, a metal-requiring, nad-dependent 6-phospho-alpha-glucosidase

SCOP Domain Sequences for d1nrhx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nrhx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis}
kksfsiviagggstftpgivlmlldhleefpirklklydndkerqdriagacdvfireka
pdiefaattdpeeaftdvdfvmahirvgkyamraldeqiplkygvvgqetcgpggiaygm
rsiggvleildymekyspdawmlnysnpaaivaeatrrlrpnskiln

SCOP Domain Coordinates for d1nrhx1:

Click to download the PDB-style file with coordinates for d1nrhx1.
(The format of our PDB-style files is described here.)

Timeline for d1nrhx1:

  • d1nrhx1 is new in SCOP 1.67
  • d1nrhx1 became obsolete in SCOP 1.69

View in 3D
Domains from same chain:
(mouse over for more information)
d1nrhx2