SCOP 1.67: Domain d1nrhx1: 1nrh X:3-169

Lineage for d1nrhx1 (1nrh X:3-169)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins)

6. Protein Maltose-6'-phosphate glucosidase GlvA [102169] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102170] (1 PDB entry)

8. Domain d1nrhx1: 1nrh X:3-169 [92087]
   Other proteins in same PDB: d1nrhx2
   complexed with g6p, mn, nad

Details for d1nrhx1

PDB Entry: 1nrh, 2.05 Å

PDB Description: crystal structure of glva gene product from bacillus subtilis, a metal-requiring, nad-dependent 6-phospho-alpha-glucosidase

SCOP Domain Sequences for d1nrhx1:

Sequence; same for both SEQRES and ATOM records:

>d1nrhx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis}
kksfsiviagggstftpgivlmlldhleefpirklklydndkerqdriagacdvfireka
pdiefaattdpeeaftdvdfvmahirvgkyamraldeqiplkygvvgqetcgpggiaygm
rsiggvleildymekyspdawmlnysnpaaivaeatrrlrpnskiln

Timeline for d1nrhx1:

• d1nrhx1 is new in SCOP 1.67
  
• d1nrhx1 does not appear in SCOP 1.69