SCOPe 2.06: Domain d1npfa_: 1npf A:

Lineage for d1npfa_ (1npf A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (84 PDB entries)

8. Domain d1npfa_: 1npf A: [92036]
   complexed with hem, no, so4

Details for d1npfa_

PDB Entry: 1npf, 1.9 Å

PDB Description: myoglobin (horse heart) wild-type complexed with nitric oxide

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1npfa_:

Sequence; same for both SEQRES and ATOM records:

>d1npfa_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

Timeline for d1npfa_:

• d1npfa_ first appeared in SCOP 1.67
  
• d1npfa_ appears in SCOPe 2.05
  
• d1npfa_ appears in SCOPe 2.07
  
• d1npfa_ appears in the current release, SCOPe 2.08