Lineage for d1npeb2 (1npe B:793-848)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031753Family g.3.11.2: Laminin-type module [57233] (1 protein)
    automatically mapped to Pfam PF00053
  6. 3031754Protein Laminin gamma1 chain [57234] (1 species)
  7. 3031755Species Mouse (Mus musculus) [TaxId:10090] [57235] (3 PDB entries)
  8. 3031760Domain d1npeb2: 1npe B:793-848 [92034]
    Other proteins in same PDB: d1npea_
    complexed with cd

Details for d1npeb2

PDB Entry: 1npe (more details), 2.3 Å

PDB Description: Crystal structure of Nidogen/Laminin Complex
PDB Compounds: (B:) Laminin gamma-1 chain

SCOPe Domain Sequences for d1npeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npeb2 g.3.11.2 (B:793-848) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]}
cqcndnidpnavgncnrltgeclkciyntagfycdrckegffgnplapnpadkcka

SCOPe Domain Coordinates for d1npeb2:

Click to download the PDB-style file with coordinates for d1npeb2.
(The format of our PDB-style files is described here.)

Timeline for d1npeb2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1npea_